Analytical Data
-
Gene name
RENT1
- Application
-
Alternative Names
ATP dependent helicase RENT1; ATP-dependent helicase RENT1; Delta helicase; FLJ43809; FLJ46894; HUPF 1; hUpf1; KIAA0221; Nonsense mRNA reducing factor 1; NORF 1; NORF1; pNORF 1; pNORF1; Regulator of nonsense transcripts 1; RENT 1; RENT1; RENT1_HUMAN; Smg 2; Smg 2 homolog nonsense mediated mRNA decay factor; UP Frameshift 1; Up frameshift mutation 1 homolog (S. cerevisiae); Up frameshift mutation 1 homolog; Up frameshift suppressor 1 homolog; Up-frameshift suppressor 1 homolog; UPF 1; UPF 1 regulator of nonsense transcripts homolog; upf1; UPF1 regulator of nonsense transcripts homolog; UPF1 RNA helicase and ATPase; Yeast Upf1p homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92900
-
Expression Region
1019-1116 aa
-
AA Sequence
GRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLS
-
Molecular Weight
36.52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RENT1, a receptor expressed on the surface of various cell types, has garnered significant attention in recent years due to its potential role in cellular signaling and immune response modulation. Research indicates that RENT1 is involved in several physiological processes, including cell proliferation, differentiation, and apoptosis. Its dysregulation has been implicated in various diseases, including cancer and autoimmune disorders, making it a target of interest for therapeutic interventions. The study of RENT1 recombinant proteins has enabled researchers to investigate its structure, function, and interaction with other molecular partners, thereby providing insights into its biological significance. Moreover, understanding the pathways associated with RENT1 could lead to the development of novel diagnostics and targeted therapies, enhancing treatment options for conditions associated with RENT1 dysregulation. As scientists continue to explore the complexities of its role in health and disease, RENT1 remains a pivotal focus in the fields of molecular biology and immunology.
