Analytical Data
-
Gene name
btfP
- Application
-
Alternative Names
btfP；Fragilysin
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54355
-
Expression Region
26-405aa
-
AA Sequence
ACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVSVKINIDKAKKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTIYPNEVSAQMQDAANSVYAVHGLKRYVNFHFVLYTTEYSCPSGDAKEGLEGFTASLKSNPKAEGYDDQIYFLIRWGTWDNKILGMSWFNSYNVNTASDFEASGMSTTQLMYPGVMAHELGHILGAEHTDNSKDLMYATFTGYLSHLSEKNMDIIAKNLGWEAADGD
-
Molecular Weight
46.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
btfP is a protein that has garnered significant attention in the field of molecular biology and biochemistry due to its potential applications in various areas, including biotechnology and medicine. Originally discovered in organisms such as bacteria, btfP plays a crucial role in cellular processes and has been implicated in the regulation of important biological pathways. Its unique structural and functional properties make it an attractive candidate for further study, particularly in the context of protein engineering and therapeutic applications. Researchers are particularly interested in the protein's ability to undergo conformational changes and its interactions with other biomolecules, which could lead to the development of novel therapeutic strategies for diseases. Additionally, understanding the mechanisms by which btfP exerts its effects at the molecular level can provide insights into fundamental biological processes. As the demand for innovative solutions in drug design and synthetic biology continues to grow, btfP represents a promising avenue for research that could yield significant advancements in both academic and applied sciences. The ongoing exploration of btfP's structure-function relationships and its potential utility in diverse biological systems underscores the importance of this protein in current scientific inquiries.
