Analytical Data
-
Gene name
CACNG3
- Application
-
Alternative Names
Neuronal voltage-gated calcium channel gamma-3 subunit;Transmembrane AMPAR regulatory Protein gamma-3;TARP gamma-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60359
-
Expression Region
1-315aa
-
AA Sequence
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV
-
Molecular Weight
37.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CACNG3, also known as the gamma subunit of voltage-gated calcium channels, has garnered significant interest in recent years due to its pivotal role in neuronal signaling and calcium homeostasis. As a crucial component of the calcium channel complex, CACNG3 influences the kinetics and voltage dependence of calcium ion influx, thereby affecting neurotransmitter release and synaptic plasticity. Research has shown that mutations or dysregulation of CACNG3 can be linked to various neurological disorders, including epilepsy and schizophrenia. The recombinant expression of CACNG3 protein allows for detailed structural and functional studies, enabling scientists to investigate its interaction with other channel subunits and its impact on calcium channel physiology. Furthermore, understanding the mechanisms by which CACNG3 modulates calcium signaling can provide insights into therapeutic targets for neurological diseases. By utilizing techniques such as X-ray crystallography and electrophysiological assays, researchers aim to elucidate the functional properties of CACNG3, paving the way for novel strategies in drug development and intervention in calcium-related pathologies.
