Cat: PA2000-2689

Recombinant E.coli petE Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    petE

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    petE;Plastocyanin minor isoform. chloroplastic

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P50057

  • Expression Region

    35-131aa

  • AA Sequence

    ATVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE

  • Molecular Weight

    26.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of petE recombinant protein has gained significant attention due to its role in various biochemical processes involving electron transport and energy conversion in photosynthetic organisms. PetE, a small soluble protein found in the thylakoid membranes of chloroplasts, plays a crucial role in the transfer of electrons from plastocyanin to photosystem I, facilitating efficient photosynthesis. Understanding the structure and function of petE is essential for elucidating the intricate mechanisms of photosynthesis and its regulation. Advances in biotechnology have enabled the production of recombinant petE, allowing researchers to investigate its properties in vitro. These studies aim to explore petE's interactions with other proteins, its stability under varying conditions, and its potential applications in bioengineering and renewable energy. Enhancing our knowledge of petE could provide insights into optimizing photosynthetic efficiency and developing improved crops, thus contributing to global food security and sustainable agricultural practices. Given the urgency of addressing climate change and energy demands, research on petE recombinant protein is not only scientifically significant but also holds promise for practical applications in biotechnological advancements.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US