Analytical Data
-
Gene name
PMAP36
- Application
-
Alternative Names
PMAP36;Antibacterial peptide PMAP-36
-
Species
Pig
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49931
-
Expression Region
130-166aa
-
AA Sequence
VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
-
Molecular Weight
20.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PMAP36, a pro-inflammatory protein derived from porcine neutrophil, has garnered attention due to its potential role in enhancing immune responses and its implications in veterinary medicine and animal health. Initial studies have suggested that PMAP36 can influence the activation and migration of immune cells, making it a candidate for research into vaccines and therapies aimed at combating infectious diseases in livestock. The protein's ability to modulate cytokine production further highlights its importance as a tool for understanding the inflammatory responses in pigs, particularly in the context of swine respiratory diseases. Given the economic impact of such diseases on the swine industry, investigating PMAP36’s structure-function relationship and its mechanisms of action could lead to innovative approaches to improve animal health and welfare. Moreover, elucidating PMAP36's interactions with other components of the immune system may pave the way for new strategies to enhance vaccination protocols and reduce antibiotic use in livestock, aligning with global efforts towards sustainable agricultural practices. The recombinant expression and functional characterization of PMAP36 not only contribute to basic scientific knowledge but also hold promise for practical applications in immunotherapy and disease prevention in veterinary contexts.











