Analytical Data
-
Gene name
RCV1
- Application
-
Alternative Names
23 kDa photoreceptor cell-specific protein; Cancer associated retinopathy protein; Cancer-associated retinopathy protein; CAR; CAR protein; p26; Protein CAR; RCV1; RCVRN; RECO_HUMAN; Recoverin; S-modulin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35243
-
Expression Region
2-200 aa
-
AA Sequence
GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RCV1, or Rous sarcoma virus (RSV) coat protein 1, is a recombinant protein that has garnered attention in research related to viral infections and host immune responses. Its study is primarily rooted in understanding the mechanisms of viral pathogenesis and the interactions between the virus and host cells. The RCV1 protein plays a crucial role in the viral life cycle, particularly in how the virus enters and replicates within host cells. Researchers are focusing on the protein’s structure and function to develop potential therapeutic strategies, including vaccines and antiviral drugs. Additionally, RCV1 is being investigated for its potential use as a model to study the cellular immune response, which is vital for designing effective immunotherapies. The ongoing research aims to elucidate the molecular pathways involved in the virus-host interaction, ultimately contributing to the broader understanding of viral diseases and leading to innovative approaches in combating viral infections. The insights gained from RCV1 research may also have implications for other viral pathogens, paving the way for advancements in virology and immunology.
