Analytical Data
-
Gene name
IFNAG
- Application
-
Alternative Names
IFNAG；IFNA7；Interferon alpha-G
-
Species
Bovine
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49877
-
Expression Region
24-189aa
-
AA Sequence
CHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQFFSVEGSAVVWDESLLDKLRDALDQQLTDLQFCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQERFRRKD
-
Molecular Weight
21.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interferon alpha-n3 (IFNAG) is a type of recombinant protein that plays a significant role in the immune response to viral infections. It belongs to the family of interferons, which are cytokines produced by host cells in response to pathogens. Initially derived from human leukocytes, IFNAG exhibits antiviral, antiproliferative, and immunomodulatory activities, making it a potent therapeutic candidate for various infectious diseases and certain malignancies. The study and development of IFNAG focus on its mechanism of action, which involves the binding of the protein to specific receptors on the surface of cells, triggering a cascade of signaling pathways that enhance the antiviral state of the cell and activate immune responses. Research has highlighted its potential applications not only in treating viral infections like hepatitis and HIV but also in managing autoimmune disorders and certain cancers. Moreover, advances in recombinant DNA technology have facilitated the production of IFNAG with improved efficacy and safety profiles, paving the way for clinical applications. Despite its therapeutic promise, ongoing studies are essential to fully understand its pharmacokinetics, optimal dosing strategies, and long-term effects. As researchers continue to explore IFNAG's full potential, it remains a focal point in the landscape of antiviral and anticancer therapies.
