Analytical Data
-
Gene name
MSA2
- Application
-
Alternative Names
MSA2；MSA2；Merozoite surface Protein 2
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50498
-
Expression Region
109-246aa
-
AA Sequence
NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
-
Molecular Weight
16.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MSA2 protein, a key component in various biochemical pathways, has garnered significant interest in the research community due to its potential implications in cellular processes and disease mechanisms. This protein, part of the MSA (matrix structural anchor) family, is known to play a crucial role in cell adhesion, migration, and signal transduction, impacting cell behavior and tissue integrity. Recent studies have revealed that alterations in MSA2 expression are associated with various pathological conditions, including cancer progression and neurodegenerative diseases. Consequently, understanding the structure and function of MSA2 is vital for unraveling its role in health and disease. Researchers are employing a range of techniques, such as recombinant protein expression and purification, to investigate MSA2’s interactions with other cellular proteins and its influence on signaling pathways. The development of MSA2 recombinant proteins not only facilitates the study of its biological functions but also holds promise for developing targeted therapeutic strategies. As the field advances, elucidating the mechanisms by which MSA2 contributes to cellular processes may lead to novel insights into disease treatment and prevention, highlighting the importance of continued research on this multifaceted protein.
