Analytical Data
-
Gene name
C9orf95
- Application
-
Alternative Names
C9orf95; Nicotinamide riboside kinase 1; Nicotinic acid riboside kinase 1; Nik-related Protein kinase; NRK 1; NRK; NRK_HUMAN; Ribosylnicotinamide kinase 1; Ribosylnicotinic acid kinase 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z2Y5
-
Expression Region
1-199aa
-
AA Sequence
MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA
-
Molecular Weight
49.6 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf95, a gene located on chromosome 9, has gained significant attention in recent years due to its potential involvement in various neurological disorders, particularly those associated with neurodegeneration. Research has shown that mutations in the C9orf72 gene, closely related to C9orf95, are linked to amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD). These conditions may arise from a pathological accumulation of dipeptide repeats produced by the expansion of a G4C2 repeat sequence. C9orf95, as a protein expressed in the central nervous system, is hypothesized to play a crucial role in cellular mechanisms and neuronal function. Studies have suggested that C9orf95 interacts with various signaling pathways, contributing to neuromodulation and synaptic plasticity. The recombinant expression of C9orf95 provides a valuable tool for probing its function and understanding the molecular underpinnings of associated diseases. Analyzing the structural and functional properties of this protein can offer insights into its potential as a therapeutic target in neurodegenerative disorders. New strategies utilizing C9orf95 and its pathways may pave the way for novel intervention approaches, underscoring the importance of continued research in this rapidly evolving field.
