Analytical Data
-
Gene name
nifH1
- Application
-
Alternative Names
nifH1；Nitrogenase iron Protein 1
-
Species
Methanobacterium
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51602
-
Expression Region
1-275aa
-
AA Sequence
MVRKIAIYGKGGIGKSTTTQNTASAMAHFHNQRVMIHGCDPKADSTRMILGGKMQTTMMDTLREEGEEACMDLDNVMSTGFKDIKCVESGGPEPGVGCAGRGVITAITIMEHMKVYDDNDFVFFDVLGDVVCGGFAMPIRDGKAEEIYIVASGEMMALYAANNLCKGMVKYAEQSGVRLGGIICNSRNVDGEKELLEEFCKRIGTQMIHFVPRDNIVQKAEFNKRTVVDFDAECSQAHEYSELARKIIENDNFVIPDPMTMDELEEMVVSYGLMD
-
Molecular Weight
37.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The nifH1 gene encodes a key component of nitrogenase, an enzyme critical for biological nitrogen fixation, which allows certain organisms to convert atmospheric nitrogen into ammonia, a form that can be utilized by plants. Research on the nifH1 recombinant protein has gained significant attention due to its potential applications in agriculture and environmental sustainability. By studying this protein, scientists aim to understand the molecular mechanisms underlying nitrogen fixation and the regulation of nitrogenase activity. With the increasing demand for sustainable agricultural practices to support a growing global population, exploring nifH1 and its recombinant forms could lead to the development of biofertilizers or genetically engineered crops that require less chemical nitrogen fertilizers. Additionally, insights gained from nifH1 research can contribute to biotechnological advances in microbial ecology, biodiversity preservation, and the enhancement of soil health. The ability to produce and characterize recombinant nifH1 proteins in various expression systems opens up opportunities for structural studies, functional assays, and the exploration of its interaction with other components of the nitrogen-fixing machinery. Overall, the investigation of the nifH1 recombinant protein stands at the intersection of applied microbiology, biochemistry, and agricultural science, with the potential to address both food security and environmental challenges.
