Cat: PA2000-2676

Recombinant Methanobacterium nifH1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    nifH1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    nifH1;Nitrogenase iron Protein 1

  • Species

    Methanobacterium

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51602

  • Expression Region

    1-275aa

  • AA Sequence

    MVRKIAIYGKGGIGKSTTTQNTASAMAHFHNQRVMIHGCDPKADSTRMILGGKMQTTMMDTLREEGEEACMDLDNVMSTGFKDIKCVESGGPEPGVGCAGRGVITAITIMEHMKVYDDNDFVFFDVLGDVVCGGFAMPIRDGKAEEIYIVASGEMMALYAANNLCKGMVKYAEQSGVRLGGIICNSRNVDGEKELLEEFCKRIGTQMIHFVPRDNIVQKAEFNKRTVVDFDAECSQAHEYSELARKIIENDNFVIPDPMTMDELEEMVVSYGLMD

  • Molecular Weight

    37.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The nifH1 gene encodes a key component of nitrogenase, an enzyme critical for biological nitrogen fixation, which allows certain organisms to convert atmospheric nitrogen into ammonia, a form that can be utilized by plants. Research on the nifH1 recombinant protein has gained significant attention due to its potential applications in agriculture and environmental sustainability. By studying this protein, scientists aim to understand the molecular mechanisms underlying nitrogen fixation and the regulation of nitrogenase activity. With the increasing demand for sustainable agricultural practices to support a growing global population, exploring nifH1 and its recombinant forms could lead to the development of biofertilizers or genetically engineered crops that require less chemical nitrogen fertilizers. Additionally, insights gained from nifH1 research can contribute to biotechnological advances in microbial ecology, biodiversity preservation, and the enhancement of soil health. The ability to produce and characterize recombinant nifH1 proteins in various expression systems opens up opportunities for structural studies, functional assays, and the exploration of its interaction with other components of the nitrogen-fixing machinery. Overall, the investigation of the nifH1 recombinant protein stands at the intersection of applied microbiology, biochemistry, and agricultural science, with the potential to address both food security and environmental challenges.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US