Analytical Data
-
Gene name
C9orf156
- Application
-
Alternative Names
TRMO; C9orf156; HSPC219; tRNA; adenine(37)-N6)-methyltransferase; EC 2.1.1.-; tRNA methyltransferase O
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BU70
-
Expression Region
1-441aa
-
AA Sequence
MRGLEEPGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRIKPASEPVHMTGPVGSLVSLGS
-
Molecular Weight
75 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf156, a gene located on chromosome 9, has recently garnered attention in molecular biology and genetics due to its potential implications in various biological processes and diseases. Although the exact function of C9orf156 remains largely unexplored, studies suggest a role in cellular signaling and immune responses. Its expression pattern indicates involvement in neurological and immunological contexts, hinting at possible links to neurodegenerative diseases and immune disorders. Researchers have focused on producing recombinant C9orf156 protein to investigate its functional properties, interaction with other proteins, and impact on cellular pathways. By generating this protein in a controlled laboratory setting, scientists aim to elucidate its biological role and assess its potential as a biomarker or therapeutic target. Understanding C9orf156 at the protein level may reveal insights into its contribution to disease mechanisms, ultimately paving the way for novel diagnostic and treatment strategies. The ongoing research into C9orf156 emphasizes the importance of exploring uncharacterized proteins to uncover new facets of human health and disease.
