Analytical Data
-
Gene name
HIST1H3A
- Application
-
Alternative Names
HIST1H3A；H3FA；HIST1H3A；H3C2；Histone H3.1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68431
-
Expression Region
2-136aa
-
AA Sequence
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
-
Molecular Weight
18.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H3A, a member of the histone H3 family, is a core component of the nucleosome, playing a crucial role in the packaging of DNA within the cell nucleus. The study of HIST1H3A, particularly in the context of recombinant protein production, has gained significance due to its implications in various biological processes, including gene regulation, DNA repair, and chromatin remodeling. Abnormal expression or mutations in histone genes like HIST1H3A have been associated with several diseases, including cancer, highlighting its importance in cellular function and pathology. Recombinant HIST1H3A protein can be utilized in various research applications, such as structural studies and the investigation of histone modifications, which are essential for understanding epigenetic mechanisms. Moreover, producing HIST1H3A in a controlled bacterial expression system allows for the generation of pure protein, facilitating detailed biophysical and biochemical characterization. This research not only elucidates the fundamental roles of histones in chromatin biology but also paves the way for potential therapeutic approaches targeting histone-related pathways in cancer and other diseases, indicating a promising area of continued exploration in molecular biology and medicine.
