Analytical Data
-
Gene name
RBM12B
- Application
-
Alternative Names
RBM12B; RNA-binding protein 12B; RNA-binding motif protein 12B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IXT5
-
Expression Region
1-765 aa
-
AA Sequence
MAVVIRLLGLPFIAGPVDIRHFFTGLTIPDGGVHIIGGEIGEAFIIFATDEDARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVDSLSNFIESVKEEASNSGYGSSINQDAGFHTNGTGHGNLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCVDGVIFLKHHDGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFIEVMQGSEQQWIEFGGNAVKEGDVLRRFEEHSPPRGINDRHFRKRSHSKSPRRTRSRSPLGFYVHLKNLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKKRSGSLERDRPGHVSQKYSQEGNSGQKLCIYIRNFPFDVTKVEVQKFFADFLLAEDDIYLLYDDKGVGLGEALVKFKSEEQAMKAERLNRRRFLGTEVLLRLISEAQIQEFGVNFSVMSSEKMQARSQSRERGDHSHLFDSKDPPIYSVGAFENFRHQLEDLRQLDNFKHPQRDFRQPDRHPPEDFRHSSEDFRFPPEDFRHSPEDFRRPREEDFRRPSEEDFRRPWEEDFRCPPEDDFRHPREEDWRRPPPEHFGGLPQSTSGGHPQSTSGGHPQSISGARPRSTSGDRPRSISGGHLRSISGAPERKISGTHQMKTSGALLMKTLGTLLMRTSGAPRRKILDALLMRTSGSSQRKTLGKLRRRTLDFLTILDLLVRILGARLMILEVTALL
-
Molecular Weight
113.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RBM12B (RNA-binding motif protein 12B) is a member of the RBM family, which is characterized by RNA-binding domains that play critical roles in post-transcriptional regulation of gene expression. Research into RBM12B has gained attention due to its potential involvement in various biological processes, including RNA splicing, stability, and translation. The protein has been implicated in several cellular pathways, and its expression levels may be associated with certain diseases, making it a subject of interest in cancer research and developmental biology. Given the complexity of RNA regulation in health and disease, understanding the functional roles of RBM12B and its interactions with RNA and other proteins is essential. Recent studies have begun to elucidate its mechanisms of action, revealing its contributions to cell proliferation and differentiation. Investigating RBM12B's structure, function, and interaction networks holds promise for unveiling new therapeutic targets and strategies, particularly in cancers where its dysregulation may contribute to tumorigenesis. This research could broaden our understanding of RNA biology and its implications in disease, highlighting the importance of RBM12B as a key player in the regulation of gene expression.
