Analytical Data
-
Gene name
Ces1c
- Application
-
Alternative Names
Ces1c；Es1；Carboxylesterase 1C
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23953
-
Expression Region
19-550aa
-
AA Sequence
HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
-
Molecular Weight
63.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ces1c, a member of the carbohydrate esterase family, has gained attention in recent years due to its role in the hydrolysis of ester bonds in carbohydrate compounds. This protein is particularly relevant in the context of microbial metabolism, where it aids in the breakdown of complex polysaccharides, facilitating nutrient acquisition for microbes in various environments. The study of Ces1c is pivotal in understanding its potential applications in biotechnology, such as in the development of biocatalysts for the food and biofuel industries. Additionally, the enzyme's ability to modify glycoproteins and its involvement in biopolishing processes underscore its significance in industrial applications. Researchers focus on the structural and functional characterization of Ces1c to elucidate its catalytic mechanisms and optimize its efficiency. Advances in recombinant protein technology have enabled the production of Ces1c in heterologous systems, allowing for high-yield isolation and characterization. This research not only enhances our knowledge of enzymatic processes but also opens doors for innovative applications in various fields, including pharmaceuticals and environmental bioremediation, making Ces1c a promising target for future studies.
