Analytical Data
-
Gene name
C8orf76
- Application
-
Alternative Names
C8orf76; Uncharacterized Protein C8orf76
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96K31
-
Expression Region
1-380aa
-
AA Sequence
MDSGCWLFGGEFEDSVFEERPERRSGPPASYCAKLCEPQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVMGEDIPEKIKDEVHPEVKCVGSVALTALVTVSSEEFEDKWFRKIKDHFCPFENQFHTEIQILA
-
Molecular Weight
69.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C8orf76, also known as chromosome 8 open reading frame 76, is a protein-coding gene located on chromosome 8. Research into C8orf76 has gained attention due to its potential implications in various biological processes and disease mechanisms. Preliminary studies have suggested that C8orf76 may play a role in cellular functions related to proliferation, differentiation, and apoptosis. Understanding the structure and function of C8orf76 could provide insights into its involvement in pathologies, such as cancer, where dysregulation of similar proteins has been implicated. Additionally, recombinant protein studies of C8orf76 allow researchers to explore its biochemical properties and interactions with other cellular components. This research pathway is particularly significant as it may uncover novel therapeutic targets or biomarkers for diseases associated with C8orf76 dysregulation. Expanding our knowledge of C8orf76 through recombinant protein technology may ultimately contribute to advancements in molecular biology, genetics, and clinical therapeutics.











