Analytical Data
-
Gene name
pKIWI502
- Application
-
Alternative Names
pKIWI502；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43394
-
Expression Region
1-317aa
-
AA Sequence
MSITLSRPSLSRPSLSRHPSLTLHSSLSHAPPHHRPVAFLRHPTLRYHHHGRLLSVASAILQDTAIRQDTYIWTPVPISRVLPAAAESLFKVIVDLSRSPDLVYNFVSPGQYVQIRIPEAIVNPPPRPAYFYIASPPSLVKKNLEFEFLIRSVPGTTSEVLCSLKEGDVVDLTQIIGRGFDIEQILPPEDYPTVLISVTGYGMSAGRSFIEEGFGANKRSDVRLYYGAENLETMGYQERFKDWEASGVRVIPVLSRPPPNWNGAVGYVQDVYLKDKPIADPRTTGAVLIGNPNMVEETRGILVAQGVSREKILVTQD
-
Molecular Weight
51.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
pKIWI502 is a recombinant protein that has garnered significant interest in the field of molecular biology and protein engineering. This protein is derived from the pKiwi plasmid system, which is designed for the expression of proteins in various host organisms. The motivation behind researching pKIWI502 lies in its potential applications in biomedicine and biotechnology. Specifically, studies have suggested that pKIWI502 may play a crucial role in understanding protein-protein interactions, enzyme functions, and signal transduction pathways. Additionally, its ability to facilitate the production of modified proteins makes it a valuable tool for therapeutic development, including the design of novel drugs and vaccines. Researchers are particularly focused on characterizing the structural and functional properties of pKIWI502, as these insights could lead to advancements in targeted therapies for diseases. The ongoing exploration of pKIWI502 also aims to uncover its interactions within cellular systems, offering a deeper understanding of its biological significance and paving the way for innovative applications in genetic engineering and synthetic biology. Through various experimental approaches, including mutagenesis and cryo-electron microscopy, the full potential of pKIWI502 continues to be unveiled, contributing to the broader knowledge of recombinant proteins and their implications in health and disease.
