Analytical Data
-
Gene name
SOCS3
- Application
-
Alternative Names
SOCS3；CIS3；SSI3；Suppressor of cytokine signaling 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14543
-
Expression Region
1-225aa
-
AA Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSA VTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGG SFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQ PSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGH LDSYEKVTQLPGPIREFLDQYDAPL
-
Molecular Weight
50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Suppressor of Cytokine Signaling 3 (SOCS3) is a key regulatory protein that plays a critical role in the inhibition of cytokine signaling pathways, particularly in the context of the Janus kinase (JAK)-signal transducer and activator of transcription (STAT) signaling cascade. SOCS3 is traditionally recognized for its negative feedback mechanism that helps to modulate immune responses and maintain cellular homeostasis. Dysregulation of SOCS3 has been implicated in a variety of pathological conditions, including autoimmune diseases, inflammatory responses, and cancer. The recombinant expression of SOCS3 protein has garnered significant interest in the research community, as it enables the study of its functional dynamics and its potential therapeutic applications. By generating recombinant SOCS3, researchers can investigate its role in signaling pathways and assess its influence on cellular processes such as proliferation, differentiation, and apoptosis. Furthermore, the ability to produce this protein in a controlled manner allows for the exploration of SOCS3 as a potential biomarker and therapeutic target in disease models, with the hope of uncovering new strategies for the treatment of SOCS3-related disorders. Understanding the mechanisms by which SOCS3 functions could lead to innovative approaches in manipulating immune responses and addressing various diseases, emphasizing the importance of this research in both basic science and clinical applications.
