Analytical Data
-
Gene name
H2B
- Application
-
Alternative Names
H2B；H2BFF；HIST1H2BB；Histone H2B type 1-B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33778
-
Expression Region
2-126aa
-
AA Sequence
PEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
-
Molecular Weight
29.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2B recombinant proteins are important components in the field of molecular biology and biochemistry, particularly for studying chromatin structure and function. Histone H2B, as a core component of nucleosomes, plays a crucial role in DNA packaging within the cell nucleus and is involved in regulating gene expression through epigenetic modifications. The study of H2B recombinant proteins facilitates the understanding of histone post-translational modifications, such as methylation and acetylation, which are key regulators of chromatin dynamics. By producing H2B in recombinant forms, researchers can investigate its interactions with other histones and non-histone proteins, key regulatory pathways, and its implications in various biological processes, including cell cycle regulation, DNA repair, and transcriptional regulation. Furthermore, the use of recombinant H2B proteins allows for the development of experimental models that mimic physiological conditions, providing insights into the mechanisms underlying diseases, such as cancer, where histone modifications play a significant role. Consequently, the research on H2B recombinant proteins is pivotal for advancing our understanding of genetics and epigenetics, with potential applications in therapeutic interventions and biotechnology.
