Analytical Data
-
Gene name
C7orf63
- Application
-
Alternative Names
CFAP69; C7orf63Cilia- and flagella-associated Protein 69
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A5D8W1
-
Expression Region
1-229aa
-
AA Sequence
MWTEEAGATAEAQESGIRNKSSSSSQIPVVGVVTEDDEAQDVFKPMDLNRVIKLLEETDKDGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRFIESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLENQLVEKLWVLKVLQHLSTSGL
-
Molecular Weight
52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C7orf63, also known as chromosome 7 open reading frame 63, has garnered attention in recent years due to its potential involvement in various biological processes and diseases. Initially identified through genome-wide association studies, current research suggests that C7orf63 may play a role in cellular functions such as cell proliferation, apoptosis, and immune responses. Its expression patterns have been linked to different types of cancers and autoimmune diseases, highlighting its significance in human health. The production and characterization of recombinant C7orf63 protein have become crucial for elucidating its function and potential therapeutic applications. By generating this protein in a controlled laboratory setting, researchers can study its biochemical properties, interactome, and effects on cellular mechanisms in detail. Furthermore, understanding the structure-function relationship of C7orf63 is essential for developing targeted interventions, especially in pathological conditions where its dysregulation is implicated. Consequently, ongoing studies on recombinant C7orf63 are expected to pave the way for novel diagnostic and therapeutic strategies aimed at modulating its activity in various diseases.
