Analytical Data
-
Gene name
C7orf61
- Application
-
Alternative Names
C7orf61Uncharacterized Protein C7orf61
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZ16
-
Expression Region
1-206aa
-
AA Sequence
MVVVMKFFRWVRRAWQRIISWVFFWRQKIKPTISGHPDSKKHSLKKMEKTLQVVETLRLVELPKEAKPKLGESPELADPCVLAKTTEETEVELGQQGQSLLQLPRTAVKSVSTLMVSALQSGWQMCSWKSSVSSASVSSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL
-
Molecular Weight
50.3 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C7orf61, also known as chromosome 7 open reading frame 61, is a gene located on human chromosome 7 that has gained attention due to its potential roles in various biological processes and diseases. Initial studies have suggested that C7orf61 may be involved in cellular mechanisms such as stress response, proliferation, and differentiation. Moreover, its dysregulation has been linked to cancer progression and other pathological conditions, indicating its importance in health and disease. The protein encoded by C7orf61 has been observed to interact with key cellular pathways, making it a candidate for further investigation. The expression patterns and functional characterization of C7orf61 recombinantly expressed in different cellular systems are crucial for elucidating its biological role. By producing and analyzing the recombinant protein, researchers aim to delve deeper into its structure-function relationship and potential as a biomarker or therapeutic target in clinical settings. Overall, the exploration of C7orf61's function and regulation presents an exciting opportunity for advancing our understanding of its impact on human health, particularly in relation to malignancies and other disorders.
