Analytical Data
-
Gene name
RASAL3
- Application
-
Alternative Names
RASAL3; RAS protein activator like-3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86YV0
-
Expression Region
1-264 aa
-
AA Sequence
MRLPLPPAQVHSSLSAGEKPGFLAPRDLPKHTPLISKSQSLRSVRRSESWARPRPDEERPLRRPRPVQRTQSVPVRRPARRRQSAGPWPRPKGSLSMGPAPRARPWTRDSASLPRKPSVPWQRQMDQPQDRNQALGTHRPVNKLAELQCEVAALREEQKVLSRLVESLSTQIRALTEQQEQLRGQLQDLDSRLRAGSSEFDSEHNLTSNEGHSLKNLEHRLNEMERTQAQLRDAVQSLQLSPRTRGSWSQPQPLKAPCLNGDTT
-
Molecular Weight
56.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RASAL3, a member of the RAS GTPase-activating protein (GAP) family, plays a crucial role in the regulation of RAS signaling pathways, which are pivotal for various cellular functions, including proliferation, differentiation, and survival. Dysregulation of RAS signaling is often implicated in cancer and other diseases, making RASAL3 a significant focus for therapeutic research. Initial studies have shown that RASAL3 can negatively regulate RAS activity, thus serving as a potential tumor suppressor. Its expression levels are altered in certain cancers, suggesting a relationship between its function and tumorigenesis. Researchers have been investigating the structural and functional properties of RASAL3, including the identification of specific domains responsible for its GAP activity and the mechanisms by which it interacts with RAS and other cellular partners. Understanding the molecular mechanisms underlying RASAL3 function could provide insights into its role in cancer progression and open new avenues for targeted therapies. Furthermore, as RASAL3 may also have implications in neurological disorders and immune responses, its comprehensive study could advance our understanding of its multifaceted roles in human health and disease.
