Analytical Data
-
Gene name
C7orf59
- Application
-
Alternative Names
AV006840; C7orf59; CG059_HUMAN; Chromosome 7 open reading frame 59 ; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4; Ragulator complex Protein LAMTOR4; UPF0539 Protein C7orf59
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q0VGL1
-
Expression Region
1-99aa
-
AA Sequence
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
-
Molecular Weight
10.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C7orf59, also known as Chromosome 7 Open Reading Frame 59, is a gene located on chromosome 7 that has attracted attention due to its potential roles in cellular processes and disease mechanisms. While the precise function of C7orf59 remains largely uncharacterized, early studies suggest that it may be involved in important biological pathways, potentially influencing aspects of immune response, cell proliferation, and apoptosis. Recent advances in proteomics have enabled researchers to produce recombinant C7orf59 protein for further investigation, allowing detailed analysis of its structural properties and function. Understanding the expression patterns and interaction networks of C7orf59 is crucial, as its dysregulation may be implicated in various pathological conditions, including cancer and autoimmune diseases. As a result, the study of C7orf59 recombinant protein is a promising area of research, providing insights into its role in human health and disease, and potentially paving the way for novel therapeutic strategies targeting pathways involving this gene. Continued exploration of C7orf59 could uncover its clinical relevance and contribute to the broader understanding of genomic influences on health.
