Analytical Data
-
Gene name
C7orf47
- Application
-
Alternative Names
Protein phosphatase 1 regulatory subunit 35
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAP8
-
Expression Region
1-253aa
-
AA Sequence
MMMGCGESELKSADGEEAAAVPGPPPEPQVPQLRAPVPEPGLDLSLSPRPDSPQPRHGSPGRRKGRAERRGAARQRRQVRFRLTPPSPVRSEPQPAVPQELEMPVLKSSLALGLELRAAAGSHFDAAKAVEEQLRKSFQIRCGLEESVSEGLNVPRSKRLFRDLVSLQVPEEQVLNAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA
-
Molecular Weight
54.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C7orf47, also known as Chromosome 7 Open Reading Frame 47, is a protein-coding gene located on chromosome 7 that has garnered interest in recent years due to its potential implications in various biological processes and diseases. Research into C7orf47 has suggested its involvement in immune responses, cellular signaling, and metabolism, making it a candidate for further investigation in fields like oncology and infectious diseases. The protein’s structure and function remain poorly understood, largely because of the limited experimental data available. Recent advances in recombinant protein technology enable the production of C7orf47 in a purified form, allowing researchers to explore its biochemical properties and interactions with other cellular molecules. Investigating the recombinant C7orf47 protein can provide insights into its role in pathophysiological contexts, ultimately contributing to the development of novel therapeutic strategies. Additionally, understanding the molecular mechanisms underlying C7orf47's function may help elucidate its potential as a biomarker for certain diseases. Overall, the study of recombinant C7orf47 protein represents a promising avenue for expanding our knowledge of this intriguing gene and its relevance to human health.
