Analytical Data
-
Gene name
C5orf30
- Application
-
Alternative Names
C5orf30; CE030_HUMAN; chromosome 5 open reading frame 30; D1Ertd622e; FLJ25291; UNC119-binding Protein C5orf30
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96GV9
-
Expression Region
1-206aa
-
AA Sequence
MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKCTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKSLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEPADTEVLQYQLQHLTLRGDRVFARNNT
-
Molecular Weight
49.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C5orf30, also known as the "Chromosome 5 open reading frame 30," is a relatively less-understood protein that has garnered attention due to its potential role in immune regulation and disease mechanisms. Emerging research suggests that C5orf30 may be involved in modulating inflammatory responses and could play a critical role in conditions such as autoimmune diseases and certain cancers. This has led to increasing interest in understanding its biological functions and underlying mechanisms at the molecular level. Studies indicate that C5orf30 may interact with various signaling pathways, influencing the immune landscape. Additionally, its expression profiles in different tissues and pathological states highlight its potential as a biomarker for disease diagnosis or prognosis. The recombinant protein of C5orf30 is being developed to facilitate in-depth investigations of its molecular interactions and functional implications. Such studies may ultimately contribute to the discovery of novel therapeutic strategies targeting immune-related disorders and improving patient outcomes. As the research landscape evolves, elucidating the role of C5orf30 in health and disease will be critical for its application in clinical settings and for advancing our understanding of complex biological systems.
