Cat: PA2000-6280

Recombinant Human C5orf24 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C5orf24

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C5orf24UPF0461 Protein C5orf24

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-terminal His-Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7Z6I8

  • Expression Region

    1-188aa

  • AA Sequence

    MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQ RQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGR PLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAA FPYPMMHGRAVHGVEETSSEVKPPNE

  • Molecular Weight

    22kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C5orf24, also known as Chromosome 5 Open Reading Frame 24, is a gene located on chromosome 5 that encodes a protein whose precise biological function remains largely understudied. Recent research interest in C5orf24 has been fueled by its potential involvement in various physiological and pathological processes, including cellular signaling, development, and disease mechanisms. Its expression pattern across different tissues suggests it may play a role in specific cellular functions or responses. Furthermore, emerging evidence indicates that dysregulation of C5orf24 may be implicated in certain cancers and neurodegenerative disorders, highlighting its relevance in clinical research. To gain insights into its function, studies focusing on the recombinant expression of C5orf24 protein have been conducted to characterize its biochemical properties and interactions with other cellular components. Understanding the role of C5orf24 through recombinant technology promises to unravel its significance in health and disease and may lead to the identification of novel therapeutic targets.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US