Analytical Data
-
Gene name
aroD
- Application
-
Alternative Names
aroD；ARO1；CYAR；CYP19；Aromatase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24670
-
Expression Region
1-252aa
-
AA Sequence
MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
-
Molecular Weight
29.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on aroD recombinant protein is primarily driven by the need to better understand fundamental metabolic pathways in bacteria and their applications in biotechnology. AroD encodes an enzyme involved in the shikimic acid pathway, which is crucial for the biosynthesis of aromatic amino acids such as phenylalanine, tyrosine, and tryptophan. These amino acids are not only vital for microbial growth but also serve as precursors for a variety of pharmaceutical compounds and agricultural chemicals. The regulation of the shikimic acid pathway is of particular interest, especially in pathogenic bacteria where it is essential for survival and virulence. By studying aroD and its corresponding enzyme, researchers can uncover new targets for antibiotics, especially as antibiotic resistance becomes a growing concern globally. Additionally, the expression of aroD in a recombinant system allows for the production of the enzyme in larger quantities, facilitating in-depth biochemical studies. The insights gained from these studies can lead to innovative strategies for manipulating microbial metabolism, enhancing the production of valuable metabolites, and developing new therapeutic agents. Consequently, aroD recombinant protein research holds significant promise for both basic science and applied biotechnological advances.
