Analytical Data
-
Gene name
EPB2
- Application
-
Alternative Names
EPB2；DRT；EPHT3；EPTH3；Ephrin type-B receptor 2
-
Species
Hordeum
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25250
-
Expression Region
134-373aa
-
AA Sequence
LPPSVDWRQKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGSLVSLSEQELIDCDTADNDGCQGGLMDNAFEYIKNNGGLITEAAYPYRAARGTCNVARAAQNSPVVVHIDGHQDVPANSEEDLARAVANQPVSVAVEASGKAFMFYSEGVFTGECGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVKTYSKPKPTPRRALGARESL
-
Molecular Weight
41.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EPB2, or erythrocyte membrane protein band 2, is a crucial component of the cytoskeleton in red blood cells, playing a significant role in maintaining cell shape and stability. Recent studies have highlighted its importance in various physiological and pathological processes, including cell signaling, membrane organization, and interactions with other membrane proteins. Additionally, EPB2 has been implicated in several hematological disorders, such as hereditary spherocytosis, where mutations in the EPB2 gene can lead to abnormal red blood cell morphology and increased fragility. The urge to understand the precise mechanisms governing EPB2 function has driven research into its structure, interactions, and regulatory pathways. Advances in recombinant protein technology have enabled the expression and purification of EPB2 for detailed biophysical and functional studies. Investigating EPB2's role at the molecular level could provide insights into not only red blood cell biology but also potential therapeutic targets for related diseases. Overall, EPB2 remains a focal point of research aimed at unraveling the complexities of erythrocyte mechanics and pathophysiology.
