Analytical Data
-
Gene name
C5orf18
- Application
-
Alternative Names
Receptor expression-enhancing Protein 5. Polyposis locus Protein 1. Protein TB2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00765
-
Expression Region
1-189aa
-
AA Sequence
MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
-
Molecular Weight
21.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C5orf18, also known as chromosome 5 open reading frame 18, is a gene located on human chromosome 5 that has garnered significant interest in the field of molecular biology and medicine. Its exact biological function remains largely unexplored, but it is believed to play a role in various cellular processes and has been implicated in several diseases, including cancer. The study of C5orf18 recombinant proteins is essential for elucidating its functional properties, interactions, and potential therapeutic applications. Researchers have been focused on producing and characterizing C5orf18 recombinant proteins to investigate their structure, stability, and biological activity. This involves utilizing techniques such as recombinant DNA technology and protein expression systems to generate large quantities of the protein for further analysis. Understanding the molecular mechanisms of C5orf18 can lead to insights into its role in disease pathology and open new avenues for targeted therapies. As research progresses, it is hoped that detailed insights into the functional dynamics of C5orf18 will contribute significantly to our understanding of its potential as a biomarker or therapeutic target in various health conditions.
