Analytical Data
-
Gene name
C4orf33
- Application
-
Alternative Names
C4orf33UPF0462 Protein C4orf33
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N1A6
-
Expression Region
1-199aa
-
AA Sequence
MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDITEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRVSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI
-
Molecular Weight
49.8 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C4orf33, also known as Chromosome 4 Open Reading Frame 33, has emerged as a protein of interest in recent biological research due to its potential roles in various cellular processes and diseases. Initially identified through genomic studies, C4orf33 has been implicated in regulating gene expression and cellular differentiation, particularly in the context of neural development and cancer. The protein's precise function remains poorly understood; however, studies suggest it may participate in cellular signaling pathways, possibly affecting cell proliferation and apoptosis. Researchers are particularly interested in its potential as a biomarker for certain cancers, as aberrant expression of C4orf33 has been associated with tumorigenesis. Given its intriguing characteristics, recombinant C4orf33 proteins are being produced for functional assays and structural studies, aiming to elucidate the molecular mechanisms underlying its activity. This research could offer valuable insights into the biological significance of C4orf33, paving the way for its potential application in therapeutic interventions or as a diagnostic tool in oncology. The ongoing exploration of C4orf33 reinforces the need for further investigation to fully uncover its role in human health and disease.
