Analytical Data
-
Gene name
C4orf28
- Application
-
Alternative Names
PACRGL; C4orf28; PACRG-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N7B6
-
Expression Region
1-221aa
-
AA Sequence
MQKSEGSGGTQLKNRATGNYDQRTSSSTQLKHRNAVQGSKSSLSTSSPESARKLHPRPSDKLNPKTINPFGEQSRVPSAFAAIYSKGGIPCRLVHGSVKHRLQWECPPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIPTYCSICC
-
Molecular Weight
50.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C4orf28, located on chromosome 4, is a gene encoding a protein of yet undetermined function, which has garnered interest in the field of molecular biology and genetics. Recent studies have suggested that C4orf28 may play a role in various biological processes, including cellular differentiation and response to stress, indicating its potential importance in development and disease mechanisms. Initially, its sequence was identified through genomic projects, but comprehensive functional studies remain limited. The protein's structure suggests possible interactions with other cellular components, prompting researchers to explore its involvement in signaling pathways and cellular functions. Given the growing body of evidence linking various chromosomal regions to specific diseases, further investigation of C4orf28 may reveal critical insights into its biological roles and implications in health and disease. As a result, recombinant C4orf28 protein has become a focus of research efforts to elucidate its properties, functional mechanisms, and potential applications in therapeutic strategies or as a biomarker for disease. Understanding the biological significance of C4orf28 is essential for harnessing its potential in clinical settings, making it a valuable target for ongoing and future research endeavors.
