Analytical Data
-
Gene name
Prl3d1
- Application
-
Alternative Names
Prl3d1；Csh1；Pl-1；Pl1；Prolactin-3D1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18121
-
Expression Region
30-224aa
-
AA Sequence
SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC
-
Molecular Weight
26.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Prl3d1, also known as the phosphatase of regenerating liver 3 domain-containing protein 1, is a member of the Prl (phosphatase of regenerating liver) family, which plays pivotal roles in various biological processes, including cell signaling, metabolism, and tumor progression. Research into Prl3d1 has gained traction due to its potential involvement in cancer biology, particularly in promoting cell proliferation and tumorigenesis in various cancers. It is often overexpressed in solid tumors, suggesting a correlation between its levels and cancer severity. Understanding the structure and function of Prl3d1 at the molecular level has implications for therapeutic strategies, particularly in targeting its aberrant activity in cancer cells. Recombinant Prl3d1 protein is utilized in studies to elucidate its enzymatic functions and interactions with other cellular components, aiding in the identification of its role in cancer pathways. Additionally, exploring this protein's mechanism can reveal novel insights into its potential as a biomarker for cancer diagnosis and prognosis, alongside its utility in developing targeted therapies. As a result, the study of recombinant Prl3d1 proteins has become an important focus in biomedical research, aiming to unveil the complexities of cancer biology and enhance clinical applications.
