Analytical Data
-
Gene name
C4orf23
- Application
-
Alternative Names
TRMT44; C4orf23; METTL19; Probable tRNA; uracil-O(2)-)-methyltransferase; EC 2.1.1.211; Methyltransferase-like Protein 19
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IYL2
-
Expression Region
1-365aa
-
AA Sequence
MYGPQTQLEEDAITPNDKTLFPDVDWLIGNHSDELTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIKEVGFTCGFHVDEDCLRIPSTKRVCLVGKSRTYPSSREASVDEKRTQYIKSRRGCPVSPPGWELSPSPRWVAAGSAGHCDGQQALDARVGCVTRAWAAEHGAGPQAEGPWLPGFHPREKAERVRNCAALPRDFIDQVVLQVANLLLGGKQLNTRSSRNGSLKTWNGGESLSLAEVANELDTETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAELRPPRTTPRKKIS
-
Molecular Weight
67.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C4orf23, known as "Chromosome 4 Open Reading Frame 23," is a protein-coding gene located on chromosome 4 that has garnered attention in recent years due to its potential implications in various biological processes and diseases. Studies have suggested that C4orf23 may play a role in cellular functions such as apoptosis, proliferation, and response to stress, although its exact biological function remains largely unexplored. Given its chromosomal localization, researchers have proposed that alterations in the expression or function of C4orf23 could be linked to several conditions, including cancer, neurodegenerative diseases, and metabolic disorders. The complexity of its interactions within cellular networks presents an exciting opportunity for further investigation. Recombinant C4orf23 protein has been produced to facilitate studies aiming to elucidate its structure, function, and potential domains of activity. This research endeavor is critical not only for understanding the fundamental biology of C4orf23 but also for exploring its potential as a therapeutic target or biomarker in various pathological states. As advancements in proteomics and molecular biology continue to unfold, delineating the role of C4orf23 in health and disease could contribute significantly to the broader understanding of genomic influences in human health.











