Analytical Data
-
Gene name
VACWR062
- Application
-
Alternative Names
VACWR062；Protein OPG068
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21607
-
Expression Region
180-429aa
-
AA Sequence
IWAYLSKKDTGIEFADNDRQDIYTLFQQTGRIVHSNLTETFRDYIFPGDKTSYWVWLNESIANDADIVLNRHAITMYDKILSYIYSEIKQGRVNKNMLKLVYIFEPEKDIRELLLEIIYDIPGDILSIIDAKNDDWKKYFISFYKANFINGNTFISDRTFNEDLFRVVVQIDPEYFDNERIMSLFSTSAADIKRFDELDINNSYISNIIYEVNDITLDTMDDMKKCQIFNEDTSYYVKEYNTYLFLHESD
-
Molecular Weight
42.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VACWR062 is a recombinant protein derived from the Vaccinia virus, which is a member of the poxvirus family. Understanding the function and properties of VACWR062 is crucial for several reasons. Firstly, Vaccinia virus has been historically significant as a vaccine against smallpox, and studying its proteins can provide insights into viral mechanisms and host interactions. VACWR062, specifically, has been implicated in modulating immune responses, which makes it a potential candidate for therapeutic applications in vaccine development or immunotherapy. Research on this protein may help elucidate its role in evading the host immune system, providing valuable knowledge for designing better vaccines or antiviral strategies. Furthermore, understanding VACWR062’s structure and function may also have implications in biotechnology, where recombinant proteins are widely utilized for diagnostic and therapeutic purposes. Moreover, due to the increasing interest in viral proteins as potential treatment options for various diseases, comprehensive studies on VACWR062 could pave the way for innovative approaches in medicine. Overall, the exploration of VACWR062 not only enriches our understanding of poxviruses but also holds promise for advancements in immunology and therapeutic interventions.
