Analytical Data
-
Gene name
ORF7
- Application
-
Alternative Names
ORF7；Phospholipid-transporting ATPase DNF1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
V5N6H2
-
Expression Region
1-123aa
-
AA Sequence
MPNNNGKQQKRKKGDGQPVNQLCQMLGKIITQQNQSRGKGPGKKNKKKNPEKPHFPLATEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA
-
Molecular Weight
13.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ORF7, a gene found in various viruses, particularly those in the Coronaviridae family, has garnered significant attention in recent years due to its potential implications in viral pathogenesis and immune evasion. Research into ORF7 recombinant proteins is crucial for understanding virus-host interactions, as these proteins are often involved in modulating host immune responses, thereby facilitating viral replication and persistence. In the context of emerging viruses like SARS-CoV-2, studies of ORF7 can provide insights into the mechanisms of immune escape and virulence, which are essential for the development of effective vaccines and therapeutics. Furthermore, ORF7 proteins may serve as valuable biomarkers for disease progression and diagnosis. The recombination of ORF7 proteins enables researchers to create specific antibodies and tools for studying viral behavior, potentially revealing new therapeutic targets. Overall, the investigation of ORF7 recombinant proteins holds promise for advancing our understanding of viral biology and enhancing our strategies in combating viral diseases.
