Analytical Data
-
Gene name
C1orf50
- Application
-
Alternative Names
C1orf50; Uncharacterized Protein C1orf50
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BV19
-
Expression Region
1-199aa
-
AA Sequence
MEDAAAPGRTEGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDMLLSQSVALPPCTEPNFQGLTH
-
Molecular Weight
21.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf50, also known as Chromosome 1 Open Reading Frame 50, is a protein of considerable interest due to its potential role in various biological processes and diseases, particularly in the context of cancer and neurological disorders. The gene encoding C1orf50 is located on chromosome 1, and studies have suggested that it may be involved in cellular signaling pathways and immune responses. Research into C1orf50 has revealed its potential association with tumorigenesis, where altered expression patterns may influence cancer cell proliferation and progression. Additionally, investigations have pointed towards its possible function in neurodevelopment, raising questions about its contributions to neurological functions and disorders. Recombinant C1orf50 protein production allows for biochemical characterization and functional assays, facilitating the exploration of its role in cellular mechanisms. Understanding C1orf50’s structure-function relationships and its interactions with other cellular components could yield significant insights into its biological functions and therapeutic potentials. As such, ongoing research on recombinant C1orf50 protein aims to clarify its mechanisms of action, paving the way for potential applications in disease diagnosis and treatment.
