Analytical Data
-
Gene name
C1orf22
- Application
-
Alternative Names
alpha-1.2-mannosidase EDEM3; C1orf22; EDEM 3; edem3; EDEM3_HUMAN; ER degradation enhancer; mannosidase alpha like 3; ER degradation enhancing alpha mannosidase like 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZQ6
-
Expression Region
1-122aa
-
AA Sequence
MGGFKYGDEQPRSDWRSYRRNLEHAVLELTLFKTVPSKMEIHSSPFKCSTAPPCNTSGQGKITEHSCEPDFCCLWIDKKQNSFSSGVGNRSLDSLLIKGSSPFLVLGVRGSFGKMHPSIVAF
-
Molecular Weight
39.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf22, also known as chromosome 1 open reading frame 22, has garnered attention in recent years due to its potential involvement in various biological processes and diseases. Located on chromosome 1, C1orf22 is hypothesized to play a role in cellular signaling, immune responses, and possibly the regulation of gene expression. Research indicates that this protein may be linked to several pathological conditions, including autoimmune diseases and certain cancers, although its precise functions remain poorly understood. The study of C1orf22 recombinant protein aims to elucidate its structure and functional characteristics, providing insights into its biological roles and its interactions with other cellular components. Recombinant technology allows for the production of C1orf22 in a controlled environment, enabling the investigation of its biochemical properties, binding affinities, and potential involvement in signaling pathways. Moreover, understanding the function of C1orf22 could reveal novel therapeutic targets or biomarkers for disease diagnosis and management. Overall, the ongoing research into C1orf22 recombinant protein holds promise for advancing our knowledge of its contributions to human health and disease, which could ultimately lead to innovative treatment strategies.
