Cat: PA2000-2287

Recombinant Human ZP3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZP3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZP3;ZP3A;ZP3B;ZPC;Zona pellucida sperm-binding Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P21754

  • Expression Region

    23-387aa

  • AA Sequence

    QPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLT LGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRP VGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTF SLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPT PDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFAN DSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCC NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGPLIFLDRRG DHEVEQWALPSDTSV

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZP3, or zona pellucida glycoprotein 3, is a crucial protein involved in the fertilization process in mammals. It is a component of the zona pellucida, the glycoprotein membrane surrounding oocytes, and plays a significant role in sperm-egg recognition and binding. Research on recombinant ZP3 proteins has gained momentum due to their potential applications in reproductive biotechnology, such as in vitro fertilization (IVF) and contraceptive development. The interest in ZP3 is further fueled by its immunological properties, as it can elicit specific antibody responses that may be leveraged for immunocontraceptive strategies. Additionally, studying the structure and function of ZP3 can provide insights into the mechanisms of fertilization and potential reproductive disorders. As a recombinant protein, ZP3 can be produced in various expression systems, enabling the detailed investigation of its functional characteristics and interactions with sperm. Overall, the study of ZP3 recombinant proteins is significant for advancements in reproductive biology, fertility treatments, and the development of novel contraceptive methods.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US