Analytical Data
-
Gene name
RABGAP1L
- Application
-
Alternative Names
RABGAP1L; HHL; KIAA0471; Rab GTPase-activating protein 1-like
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5R372
-
Expression Region
1-72 aa
-
AA Sequence
MMEEISIMVAYDAHVFSQLHDEDFLTSLVAISKPRSMVPTKKLKKYEKEYQTMRESQLQQEDPMDRYKFVYL
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RABGAP1L, an important member of the RAB GTPase-activating protein family, plays a crucial role in regulating intracellular vesicular trafficking and signaling pathways. Studies have revealed that RABGAP1L is involved in the modulation of RAB proteins, which are essential for the maintenance of cellular functions such as endocytosis, exocytosis, and cellular communication. Its dysregulation has been implicated in several diseases, including cancer and neurodegenerative disorders, making it a potential therapeutic target. Recent research has focused on the mechanisms through which RABGAP1L interacts with various RAB proteins and other cellular partners, shedding light on its functional significance in health and disease. Recombinant protein studies have been undertaken to elucidate the biochemical properties of RABGAP1L, understand its catalytic activity, and identify its downstream effects, contributing to the broader understanding of cellular dynamics. This research not only highlights the fundamental biological roles of RABGAP1L but also paves the way for exploring its potential as a biomarker and therapeutic agent in relevant pathologies. The generation and characterization of RABGAP1L recombinant proteins are essential for developing targeted strategies to modulate its activity in pathological contexts.











