Cat: PA1000-5487

Recombinant Human DOT1L Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DOT1L

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DOT1L;KIAA1814;KMT4;Histone-lysine N-methyltransferase. H3 lysine-79 specific

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8TEK3

  • Expression Region

    1-435aa

  • AA Sequence

    MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPD LKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNT RPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDE IKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDR EFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVD HQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESK SNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLN KKGRKMAGRKRGRPKKMNTANPERKPKKNQTALDA

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DOT1L (Disruptor of Telomeric Silencing 1 Like) is a crucial histone methyltransferase primarily recognized for its role in mediating the methylation of histone H3 at lysine 79 (H3K79). This modification is essential for regulating gene expression, chromatin structure, and DNA repair processes. The study of DOT1L has garnered significant attention due to its implications in various cancer types, particularly in the context of mixed-lineage leukemia (MLL) rearrangements, where aberrant DOT1L activity is linked to oncogenic transformations. Researchers have begun investigating DOT1L as a potential therapeutic target, aiming to disrupt its methyltransferase activity as a means to inhibit the proliferation of cancer cells. Additionally, the exploration of DOT1L's substrate specificity and its interactions with other chromatin-modifying enzymes has provided insights into the complexity of epigenetic regulation. The development of recombinant DOT1L proteins has been pivotal for these studies, enabling the dissection of its biochemical properties and facilitating high-throughput screening for small-molecule inhibitors. As such, understanding the functional dynamics of DOT1L not only enhances our comprehension of chromatin biology but also opens new avenues for targeted cancer therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US