Analytical Data
-
Gene name
ZNF581
- Application
-
Alternative Names
ZNF581；Zinc finger Protein 581
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P0T4
-
Expression Region
1-197aa
-
AA Sequence
MASMTGGQQMGRGEFMLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGP SSSIGSPQASSPPR PNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQ KKCYSCPVCSRVFEYMSYLQRHSITHSEVK PFECDICGKAFKRASHLA RHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPH CP RRFMEQNTLQKHTRWKHP
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF581, a member of the zinc finger protein family, is encoded by the ZNF581 gene, which is located on chromosome 7 in humans. This protein has garnered interest due to its potential roles in various biological processes, including transcription regulation, cell growth, and differentiation. Studies have indicated that ZNF581 may be involved in the development and progression of certain cancers, as its expression levels have been found to be altered in various tumor types. Additionally, ZNF581 is believed to play a role in modulating immune responses and has been linked to neurodevelopmental processes. The functional characterization of ZNF581 through recombinant protein studies is crucial for understanding its biological mechanisms and potential therapeutic applications. By producing and purifying the ZNF581 recombinant protein, researchers aim to elucidate its interactions with DNA and other cellular molecules, identify its downstream targets, and investigate its impact on key signaling pathways. This research not only contributes to the fundamental understanding of ZNF581's role in cellular processes but also holds promise for the development of targeted therapies in diseases where ZNF581 is dysregulated. With the increasing focus on protein engineering and structural biology, the study of ZNF581 in a recombinant format offers valuable insights that could lead to novel diagnostic and therapeutic strategies.
