Analytical Data
-
Gene name
ZNF26
- Application
-
Alternative Names
ZNF26；KOX20；Zinc finger Protein 26
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17031
-
Expression Region
335-533aa
-
AA Sequence
MHTGEKPYQCSDCGKAFNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
-
Molecular Weight
38.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF26, or Zinc Finger Protein 26, is a member of the zinc finger protein family, characterized by its ability to bind DNA and regulate gene expression. The study of ZNF26 has gained interest due to its potential role in various biological processes, including cell differentiation, development, and response to stress. Research indicates that ZNF26 may participate in the regulation of genes involved in cancer progression and other diseases, making it a significant focus for therapeutic development. Additionally, the understanding of ZNF26's structure and function could provide insights into its mechanisms of action, revealing how alterations in its expression or activity might contribute to pathological conditions. Investigating ZNF26 through recombinant protein techniques allows researchers to produce and study this protein in controlled environments, facilitating the exploration of its binding properties, interaction with other proteins, and overall impact on cellular functions. As ongoing studies aim to elucidate the physiological and pathological roles of ZNF26, the insights gained could pave the way for innovative approaches in gene therapy and molecular medicine.
