Analytical Data
-
Gene name
C1orf192
- Application
-
Alternative Names
C1orf192; CA192_HUMAN; Chromosome 1 open reading frame 192; UPF0740 Protein C1orf192
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VTH2
-
Expression Region
1-177aa
-
AA Sequence
MATNYSANQYEKAFSSKYLQNWSPTKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANPWGSFMGTWQMPLKIPPARVTLTSRTTAGAASLTKWIQKNPDLLKASNGLCPEILGKPHDPDSQKKLRKKSITKTVQQARSPTIIPSSPAANLNSPDELQSSHPSAGHTPGPQRPAKS
-
Molecular Weight
45.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf192, also known as Chromosome 1 Open Reading Frame 192, is a relatively unexplored protein with potential implications in various biological processes and diseases. Recent genomic studies have identified C1orf192 as a novel candidate gene implicated in conditions such as cancer and autoimmune diseases. Its precise function, however, remains largely unknown due to the protein's low sequence conservation across species and lack of characterized homologs. Research on C1orf192 has gained momentum with advances in proteomics and bioinformatics, enabling scientists to study its expression patterns and potential interactions within cellular pathways. Preliminary studies suggest that C1orf192 may play a role in cellular stress responses and the regulation of gene expression. Understanding this protein's structure and function through recombinant protein techniques could reveal insight into its biological significance and therapeutic potential. Investigating C1orf192 not only aims to broaden our knowledge of human genetics but also to uncover novel biomarkers for disease diagnosis and treatment. As such, further research into C1orf192 is critical for elucidating its role in health and disease, contributing to a deeper understanding of molecular mechanisms involved in various pathophysiological conditions.
