Analytical Data
-
Gene name
C1orf190
- Application
-
Alternative Names
LURAP1; C1orf190; LRAP35A; LRP35A; Leucine rich adaptor Protein 1; Leucine repeat adapter Protein 35A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96LR2
-
Expression Region
1-239aa
-
AA Sequence
MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGPPESPEDESAKLGFEAHWFWEQCQDDVTFL
-
Molecular Weight
26.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf190, also known as chromosome 1 open reading frame 190, is a protein-coding gene that has gained attention in recent years due to its potential roles in various biological processes and diseases. Located on chromosome 1, C1orf190's exact function remains largely unexplored; however, preliminary studies suggest involvement in cellular signaling pathways and immune responses. Research indicates that altered expression of C1orf190 may be linked to inflammatory conditions and certain types of cancer, prompting investigations into its role in tumorigenesis and immune modulation. The study of recombinant C1orf190 protein holds promise for elucidating its biological functions and mechanisms of action, potentially leading to the identification of novel therapeutic targets. Expression and purification of this protein facilitate structural and functional analyses, which are crucial for understanding its interactions with other cellular components. Additionally, the development of assays to assess the activity of C1orf190 could provide insights into its involvement in health and disease. Overall, C1orf190 represents a promising avenue for research in molecular biology and could contribute to advances in targeted therapies for conditions impacted by its dysregulation. Continuing to unravel the complexities surrounding C1orf190 can foster a better understanding of the underlying mechanisms of various diseases, paving the way for innovative treatment strategies.
