Analytical Data
-
Gene name
ZNF212
- Application
-
Alternative Names
ZNF212；ZNFC150；Zinc finger Protein 212
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UDV6
-
Expression Region
1-495aa
-
AA Sequence
MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGRPNGLL
-
Molecular Weight
71.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF212, a member of the zinc finger protein family, has garnered attention in recent years due to its potential roles in various biological processes, including gene regulation and cancer biology. This protein contains multiple zinc finger domains, which are known for their ability to bind DNA and impact transcriptional activity, making ZNF212 a candidate for studying gene expression modulation. Research has indicated that ZNF212 may be involved in the regulation of developmental processes and cellular differentiation. Furthermore, emerging evidence suggests its involvement in tumorigenesis, highlighting its potential as a biomarker and therapeutic target in cancer treatment. However, the functional mechanisms and pathways mediated by ZNF212 remain not fully understood, necessitating the production and characterization of recombinant ZNF212 for detailed biochemical and structural studies. By expressing this protein in suitable systems, researchers aim to elucidate its interactions with other cellular components, such as DNA, RNA, and various transcription factors, paving the way for understanding its role in health and disease. The study of recombinant ZNF212 could lead to valuable insights into its molecular functions, ultimately contributing to the development of novel cancer therapies and advancing the field of gene regulation.
