Analytical Data
-
Gene name
TUFM
- Application
-
Alternative Names
TUFM；Elongation factor Tu. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49411
-
Expression Region
44-452aa
-
AA Sequence
AVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYE EIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAP LDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVE LVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLLDAV DTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELL GHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKP GSIKPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPP EKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAMT EEEKNIKWG
-
Molecular Weight
49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TUFM (Translation Elongation Factor Mitochondrial), a crucial protein involved in mitochondrial protein synthesis, has garnered significant attention in recent years due to its essential role in cellular metabolism and energy production. Mitochondria, often referred to as the "powerhouses" of the cell, rely on a unique set of proteins to translate mitochondrial mRNAs, which are distinct from those found in the cytosol. TUFM, as a mitochondrial elongation factor, facilitates the elongation phase of translation, ensuring the accurate synthesis of mitochondrial proteins necessary for oxidative phosphorylation and ATP production. Given the importance of mitochondrial function in various diseases, including neurodegenerative disorders and metabolic syndromes, understanding the structure and function of TUFM is crucial. Recent studies have explored its interactions with other mitochondrial ribosomal components, potential post-translational modifications, and its role in mitochondrial dynamics and biogenesis. Moreover, dysregulation of TUFM has been linked to mitochondrial dysfunction and has implications in the pathogenesis of diseases such as Alzheimer's and Parkinson's. Consequently, ongoing research aims to elucidate the molecular mechanisms governing TUFM activity, its regulatory pathways, and its potential as a therapeutic target to restore mitochondrial function and combat related diseases. With the advancement of biophysical techniques and high-resolution imaging methods, researchers are now better equipped to study TUFM's multifaceted roles in mitochondria, paving the way for novel intervention strategies aimed at enhancing mitochondrial health and function.
