Analytical Data
-
Gene name
LTC4S
- Application
-
Alternative Names
LTC4S；Leukotriene C4 synthase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16873
-
Expression Region
1-150aa
-
AA Sequence
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LTC4S (leukotriene C4 synthase) is an important enzyme involved in the biosynthesis of leukotrienes, which are lipid mediators that play essential roles in various physiological and pathological processes, including inflammation, allergic responses, and asthma. The enzyme catalyzes the conversion of leukotriene A4 (LTA4) into leukotriene C4 (LTC4), a key component of the cysteinyl leukotrienes, which are implicated in bronchoconstriction and airway hyperreactivity. Research into LTC4S is particularly significant due to its potential as a therapeutic target for treating inflammatory diseases, including asthma and chronic obstructive pulmonary disease (COPD). The understanding of LTC4S structure, function, and regulation is crucial for developing specific inhibitors that can modulate its activity and, consequently, alleviate symptoms associated with leukotriene-mediated inflammatory responses. Recent studies have focused on the recombinant expression of LTC4S, allowing for more detailed biochemical characterizations and structure-function analyses. This approach helps to uncover the enzyme's active sites, substrate interactions, and potential post-translational modifications that may influence its activity. Such investigations not only enhance our understanding of LTC4S's role in leukotriene biosynthesis but also pave the way for innovative therapeutic strategies aimed at mitigating the effects of excessive leukotriene production in inflammatory diseases.
