Analytical Data
-
Gene name
TRBC1
- Application
-
Alternative Names
TRBC1；T cell receptor beta constant 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01850
-
Expression Region
1-129aa
-
AA Sequence
DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
-
Molecular Weight
19.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TRBC1, or T-cell receptor beta chain constant region 1, plays a vital role in the immune response by forming part of the T-cell receptor complex, which is essential for T-cell development and function. Recent studies have highlighted its critical influence on T-cell signaling and differentiation, implicating TRBC1 in various autoimmune diseases and immunological disorders. Understanding TRBC1 at a molecular level is essential for developing therapeutic strategies targeting T-cell responses. The recombinant expression of TRBC1 protein allows researchers to investigate its structural and functional properties in detail, aiding in the understanding of its interactions with other proteins and potentially uncovering mechanisms underlying T-cell receptor signaling. Additionally, recombinant TRBC1 can be utilized to create specific antibodies or for the development of novel immunotherapies. As research continues to unveil the complexities of immune regulation, TRBC1 remains a promising target for enhancing our understanding of T-cell biology and harnessing the immune system for the treatment of diseases.
