Analytical Data
-
Gene name
ASAH2
- Application
-
Alternative Names
ASAH2;HNAC1;Neutral ceramidase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR71
-
Expression Region
610-780aa
-
AA Sequence
FRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
-
Molecular Weight
25.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASAH2, or acid ceramidase 2, is a lysosomal enzyme involved in sphingolipid metabolism, specifically in the hydrolysis of ceramide into sphingosine and free fatty acids. This enzyme plays a crucial role in various biological processes, including cell signaling, inflammation, and apoptosis. Dysregulation of ASAH2 has been linked to several pathological conditions, particularly in the context of neurodegenerative diseases, cancer, and metabolic disorders. Research into ASAH2 has grown significantly in recent years, driven by the need to understand its role in cellular homeostasis and disease mechanisms. Studies have shown that altered ASAH2 activity can impact cell proliferation and survival, making it a potential therapeutic target for drug development. Additionally, the importance of ASAH2 in lysosomal function highlights its relevance in lysosomal storage diseases, where its deficiency can lead to the accumulation of ceramide and other sphingolipids, exacerbating disease symptoms. As such, the investigation of recombinant ASAH2 proteins has become a focal point for studying enzyme function, developing inhibitors, and exploring gene therapy approaches. Overall, understanding the structure and function of ASAH2 is essential for elucidating its role in health and disease and has promising implications for novel therapeutic strategies.











