Cat: PA1000-5375

Recombinant Human PLA2G12B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PLA2G12B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PLA2G12B;PLA2G13;Group XIIB secretory phospholipase A2-like Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BX93

  • Expression Region

    20-195aa

  • AA Sequence

    QSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCR YGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCY DTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTV WTLGCRPFMNSQRAACICAEEEKEEL

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PLA2G12B, a member of the phospholipase A2 (PLA2) enzyme family, has gained significant attention due to its potential roles in various physiological and pathological processes. Phospholipases are known to hydrolyze phospholipids, leading to the release of free fatty acids and lysophospholipids, which are crucial for cell signaling, membrane dynamics, and inflammatory responses. PLA2G12B, in particular, is suggested to play a role in lipid metabolism, immune regulation, and even cancer progression. Its expression pattern and functional implications in different tissues highlight its importance in cellular homeostasis and disease mechanisms. Recent studies indicate that PLA2G12B may be involved in modulating inflammatory pathways, thus contributing to autoimmunity and other inflammatory disorders. Understanding the biochemical properties and regulatory mechanisms of PLA2G12B is essential for elucidating its biological functions and potential therapeutic applications. To further investigate this enzyme, researchers frequently utilize recombinant protein technology to produce and study the PLA2G12B protein in controlled experimental settings. This enables detailed analysis of its enzymatic activity, substrate specificity, and interaction with inhibitors or other biomolecules. Consequently, the characterization of PLA2G12B and its associated pathways could pave the way for novel strategies in targeted therapies for diseases where phospholipid metabolism is disrupted. As research continues to unveil the multifaceted roles of PLA2G12B, it remains a promising target for future studies aiming to develop innovative interventions in inflammation and cancer treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US