Analytical Data
-
Gene name
PLA2G12B
- Application
-
Alternative Names
PLA2G12B;PLA2G13;Group XIIB secretory phospholipase A2-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BX93
-
Expression Region
20-195aa
-
AA Sequence
QSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCR YGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCY DTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTV WTLGCRPFMNSQRAACICAEEEKEEL
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLA2G12B, a member of the phospholipase A2 (PLA2) enzyme family, has gained significant attention due to its potential roles in various physiological and pathological processes. Phospholipases are known to hydrolyze phospholipids, leading to the release of free fatty acids and lysophospholipids, which are crucial for cell signaling, membrane dynamics, and inflammatory responses. PLA2G12B, in particular, is suggested to play a role in lipid metabolism, immune regulation, and even cancer progression. Its expression pattern and functional implications in different tissues highlight its importance in cellular homeostasis and disease mechanisms. Recent studies indicate that PLA2G12B may be involved in modulating inflammatory pathways, thus contributing to autoimmunity and other inflammatory disorders. Understanding the biochemical properties and regulatory mechanisms of PLA2G12B is essential for elucidating its biological functions and potential therapeutic applications. To further investigate this enzyme, researchers frequently utilize recombinant protein technology to produce and study the PLA2G12B protein in controlled experimental settings. This enables detailed analysis of its enzymatic activity, substrate specificity, and interaction with inhibitors or other biomolecules. Consequently, the characterization of PLA2G12B and its associated pathways could pave the way for novel strategies in targeted therapies for diseases where phospholipid metabolism is disrupted. As research continues to unveil the multifaceted roles of PLA2G12B, it remains a promising target for future studies aiming to develop innovative interventions in inflammation and cancer treatment.











