Analytical Data
-
Gene name
TARDBP
- Application
-
Alternative Names
TARDBP；TDP43；TAR DNA-binding Protein 43
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13148
-
Expression Region
25-181aa
-
AA Sequence
TVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSK
-
Molecular Weight
21.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAR DNA-binding protein 43 (TARDBP), also known as TDP-43, is a crucial RNA-binding protein that plays a significant role in various cellular processes, including RNA splicing, transport, and stability. Research into TARDBP gained prominence due to its association with neurodegenerative diseases, particularly frontotemporal dementia (FTD) and amyotrophic lateral sclerosis (ALS). In these conditions, TDP-43 becomes mislocalized and forms pathological aggregates in neurons, which is believed to contribute to the neurodegenerative process. Understanding the structure and function of recombinant TARDBP protein is essential, as it provides insights into the mechanisms underlying its contribution to disease. Additionally, studying recombinant TARDBP allows researchers to investigate its interactions with RNA and other proteins, as well as to explore its post-translational modifications and the effects of disease-related mutations. These studies have the potential to elucidate how dysregulation of TARDBP contributes to the pathogenesis of ALS and FTD, paving the way for the development of targeted therapeutics aimed at mitigating its harmful effects in neurodegenerative disorders.
